PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G33450.1
Common NameATMYB69, F17M5.210, MYB69
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 250aa    MW: 28936.2 Da    PI: 9.9901
Description myb domain protein 69
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G33450.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-161964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed+ l ++v+q+G+++W+ Ia+++  gR++k+c++rw++ 
      AT4G33450.1 19 RGHWRPVEDDNLRQLVEQYGPKNWNFIAQHLY-GRSGKSCRLRWYNQ 64
                     899****************************9.************96 PP

2Myb_DNA-binding551.9e-1771114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE+e+l++a++  G++ W++Iar ++ gRt++ +k++++ 
      AT4G33450.1  71 KKPFTEEEEERLLKAHRIQGNR-WASIARLFP-GRTDNAVKNHFHV 114
                      689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.4871469IPR017930Myb domain
SuperFamilySSF466895.24E-2917112IPR009057Homeodomain-like
SMARTSM007173.4E-141867IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-252072IPR009057Homeodomain-like
CDDcd001672.40E-132263No hitNo description
PfamPF139211.2E-162282No hitNo description
PROSITE profilePS5129418.44870120IPR017930Myb domain
SMARTSM007171.5E-1470118IPR001005SANT/Myb domain
CDDcd001674.60E-1173113No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2073118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0005352anatomyxylem
PO:0005848anatomysecondary xylem
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEMSRGSNSF DNKKPSCQRG HWRPVEDDNL RQLVEQYGPK NWNFIAQHLY GRSGKSCRLR  60
WYNQLDPNIT KKPFTEEEEE RLLKAHRIQG NRWASIARLF PGRTDNAVKN HFHVIMARRK  120
RENFSSTATS TFNQTWHTVL SPSSSLTRLN RSHFGLWRYR KDKSCGLWPY SFVSPPTNGQ  180
FGSSSVSNVH HEIYLERRKS KELVDPQNYT FHAATPDHKM TSNEDGPSMG DDGEKNDVTF  240
IDFLGVGLAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-34151193107B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865159040.0
Genevisible253327_at0.0
Expression AtlasAT4G33450-
AtGenExpressAT4G33450-
ATTED-IIAT4G33450-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G33450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A), AT2G46770 (A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G17800
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G33450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1425170.0AY142517.1 Arabidopsis thaliana putative transcription factor (At4g33450) mRNA, complete cds.
GenBankAY5196110.0AY519611.1 Arabidopsis thaliana MYB transcription factor (At4g33450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195071.10.0myb domain protein 69
TrEMBLQ9SZC20.0Q9SZC2_ARATH; MYB transcription factor
STRINGAT4G33450.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  6. Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH
    A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2763-82
    [PMID:18952777]
  7. McKeown PC, et al.
    Identification of imprinted genes subject to parent-of-origin specific expression in Arabidopsis thaliana seeds.
    BMC Plant Biol., 2011. 11: p. 113
    [PMID:21838868]
  8. Chen L,Bernhardt A,Lee J,Hellmann H
    Identification of Arabidopsis MYB56 as a novel substrate for CRL3(BPM) E3 ligases.
    Mol Plant, 2015. 8(2): p. 242-50
    [PMID:25618823]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  10. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]